"ARHGAP35" Related Products

Recombinant Human ARHGAP35, His-tagged

Cat.No.: ARHGAP35-26370TH
Product Overview: Recombinant fragment, corresponding to amino acids 1055-1499 of Human GRLF1 isoform 2 with an N terminal His tag. Observed mwt: 59 kDa ;
Description: The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: DLSYLDQGHRDGQRKSVSSSPWLPQDGFDPSDYAEPMDAV VKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGN GSDSEMDTSSLERGRKVSIVSKPVLYRTRCTRLGRFAS YRTSFSVGSDDELGPIRKKEEDQASQGYKGDNAVIPYE TDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFG VPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVS GNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSF FSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLK KFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWP TLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPP PTPQSPMQPLLPSQLQAEHTL
Sequence Similarities: Contains 4 FF domains.Contains 1 Rho-GAP domain.
Gene Name: ARHGAP35 Rho GTPase activating protein 35 [ Homo sapiens ]
Official Symbol: ARHGAP35
Synonyms: ARHGAP35; Rho GTPase activating protein 35; glucocorticoid receptor DNA binding factor 1 , GRLF1; rho GTPase-activating protein 35; GRF 1; KIAA1722; P190A; p190ARhoGAP; p190RhoGAP;
Gene ID: 2909
mRNA Refseq: NM_004491
Protein Refseq: NP_004482
MIM: 605277
Uniprot ID: Q9NRY4
Chromosome Location: 19q13.32
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EPHA2 forward signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function: DNA binding; GTP binding; GTPase activator activity; Rho GTPase activator activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.