Recombinant Full Length Human ARHGAP35 Protein, GST-tagged
| Cat.No. : | ARHGAP35-5578HF |
| Product Overview : | Human GRLF1 full-length ORF ( AAH03514, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 36 amino acids |
| Description : | The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq |
| Molecular Mass : | 29.7 kDa |
| AA Sequence : | MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGAP35 Rho GTPase activating protein 35 [ Homo sapiens (human) ] |
| Official Symbol | ARHGAP35 |
| Synonyms | ARHGAP35; Rho GTPase activating protein 35; GRF-1; GRLF1; P190A; P190-A; p190RhoGAP; p190ARhoGAP; rho GTPase-activating protein 35; glucocorticoid receptor DNA-binding factor 1; glucocorticoid receptor repression factor 1; rho GAP p190A |
| Gene ID | 2909 |
| mRNA Refseq | NM_004491 |
| Protein Refseq | NP_004482 |
| MIM | 605277 |
| UniProt ID | Q9NRY4 |
| ◆ Recombinant Proteins | ||
| ARHGAP35-5363H | Recombinant Human ARHGAP35 Protein, GST-tagged | +Inquiry |
| ARHGAP35-26370H | Recombinant Human ARHGAP35 Protein, N-His tagged | +Inquiry |
| ARHGAP35-26370TH | Recombinant Human ARHGAP35, His-tagged | +Inquiry |
| ARHGAP35-5578HF | Recombinant Full Length Human ARHGAP35 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP35 Products
Required fields are marked with *
My Review for All ARHGAP35 Products
Required fields are marked with *



