Recombinant Human ARHGAP35 Protein, N-His tagged
Cat.No. : | ARHGAP35-26370H |
Product Overview : | Recombinant Human ARHGAP35 Protein with N-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. |
Form : | Lyophilized |
Molecular Mass : | 52 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDLSYLDQGHRDGQRKSVSSSPWLPQDGFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDTSSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKGDNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRPITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from 20mM PB, 200mM NaCl, 5mM EDTA, pH 6.0, 5% Trehalose, 5% Manitol |
Gene Name | ARHGAP35 Rho GTPase activating protein 35 [ Homo sapiens (human) ] |
Official Symbol | ARHGAP35 |
Synonyms | ARHGAP35; Rho GTPase activating protein 35; GRF-1; GRLF1; P190A; P190-A; p190RhoGAP; p190ARhoGAP; rho GTPase-activating protein 35; glucocorticoid receptor DNA-binding factor 1; glucocorticoid receptor repression factor 1; rho GAP p190A |
Gene ID | 2909 |
mRNA Refseq | NM_004491 |
Protein Refseq | NP_004482 |
MIM | 605277 |
UniProt ID | Q9NRY4 |
◆ Recombinant Proteins | ||
ARHGAP35-5363H | Recombinant Human ARHGAP35 Protein, GST-tagged | +Inquiry |
ARHGAP35-26370H | Recombinant Human ARHGAP35 Protein, N-His tagged | +Inquiry |
ARHGAP35-26370TH | Recombinant Human ARHGAP35, His-tagged | +Inquiry |
ARHGAP35-5578HF | Recombinant Full Length Human ARHGAP35 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP35 Products
Required fields are marked with *
My Review for All ARHGAP35 Products
Required fields are marked with *