Recombinant Human ARHGAP35 Protein, GST-tagged

Cat.No. : ARHGAP35-5363H
Product Overview : Human GRLF1 full-length ORF ( AAH03514, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq
Molecular Mass : 29.7 kDa
AA Sequence : MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGAP35 Rho GTPase activating protein 35 [ Homo sapiens (human) ]
Official Symbol ARHGAP35
Synonyms ARHGAP35; Rho GTPase activating protein 35; GRF-1; GRLF1; P190A; P190-A; p190RhoGAP; p190ARhoGAP; rho GTPase-activating protein 35; glucocorticoid receptor DNA-binding factor 1; glucocorticoid receptor repression factor 1; rho GAP p190A
Gene ID 2909
mRNA Refseq NM_004491
Protein Refseq NP_004482
MIM 605277
UniProt ID Q9NRY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGAP35 Products

Required fields are marked with *

My Review for All ARHGAP35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon