Recombinant Human ARHGAP4, His-tagged
Cat.No. : | ARHGAP4-26278TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 692-946 of Human ARHGAP4 with an N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNE PELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRR GDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTE KQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEA MGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGK TSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSR GPGAPASPSASHPQGLDTTPKPH |
Gene Name : | ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ] |
Official Symbol : | ARHGAP4 |
Synonyms : | ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4; |
Gene ID : | 393 |
mRNA Refseq : | NM_001164741 |
Protein Refseq : | NP_001158213 |
MIM : | 300023 |
Uniprot ID : | P98171 |
Chromosome Location : | Xq28 |
Pathway : | Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; |
Function : | GTPase activator activity; Rho GTPase activator activity; SH3/SH2 adaptor activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
ARHGAP4-770H | Recombinant Human ARHGAP4 protein, GST-tagged | +Inquiry |
ARHGAP4-9827H | Recombinant Human ARHGAP4, GST-tagged | +Inquiry |
◆ Lysates | ||
ARHGAP4-113HCL | Recombinant Human ARHGAP4 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (20)
Ask a questionTargeting ARHGAP4 could have therapeutic implications, especially in diseases where Rho GTPase signaling is dysregulated. Modulating ARHGAP4 activity or expression can potentially affect cellular processes such as cancer cell invasion, migration, and neuronal development. Therefore, the development of ARHGAP4-targeted therapies holds promise in certain pathological conditions.
ARHGAP4 functions as a Rho GTPase activating protein (GAP), primarily targeting members of the Rho family, including RhoA, Rac1, and Cdc42. By catalyzing the hydrolysis of GTP to GDP, ARHGAP4 negatively regulates the activity of these GTPases. This, in turn, can modulate downstream effectors and signaling pathways involved in cytoskeletal dynamics, cell migration, adhesion, and other cellular processes.
While there is limited information available regarding mutations or genetic variations specifically in ARHGAP4, alterations in Rho GTPase signaling pathways have been implicated in various human diseases, including cancer, neurological disorders, and cardiovascular diseases. Dysregulation of ARHGAP4 or its target Rho GTPases may contribute to disease progression, but further studies are needed to determine the specific genetic variations or mutations in ARHGAP4 associated with these conditions.
Yes, ARHGAP4 contains several conserved domains, including a central RhoGAP domain responsible for its GTPase-activating activity. It also possesses a pleckstrin homology (PH) domain and a proline-rich region that may contribute to its protein-protein interactions and regulation.
The regulation of ARHGAP4 at the transcriptional or post-translational level is not well understood. It is possible that ARHGAP4 expression may be regulated by various transcription factors or signaling pathways, but specific mechanisms have yet to be identified. Post-translational modifications, such as phosphorylation or ubiquitination, could also potentially regulate ARHGAP4 activity or stability, but further research is needed to elucidate these processes.
Currently, there are no specific animal models or knockout studies for ARHGAP4 available. Generating animal models or using knockout approaches could provide valuable insights into the physiological functions of ARHGAP4 and its contributions to developmental processes or disease conditions.
Animal models and knockout studies for ARHGAP4 have been utilized to investigate its physiological and pathological roles. Mice with ARHGAP4 gene knockout have been generated, providing valuable insights into its relevance in development and disease. These models contribute to understanding the consequences of ARHGAP4 deficiency and its impact on various biological processes.
Yes, ARHGAP4 has been implicated in neuronal development and synaptic plasticity. Rho GTPases are known to play crucial roles in neuronal processes, including axon guidance, dendritic spine formation, and synaptic plasticity. As an upstream regulator of Rho GTPases, ARHGAP4 can influence these processes, although the specific mechanisms are not fully elucidated.
Yes, ARHGAP4 can interact with other proteins to form complexes or be part of signaling networks. These interactions help regulate its activity and participate in specific cellular functions. Characterizing these protein-protein interactions is essential to understand the broader functional roles of ARHGAP4.
ARHGAP4 acts as a GTPase-activating protein (GAP) for Rho GTPases. It stimulates the hydrolysis of GTP (guanosine triphosphate) to GDP (guanosine diphosphate) on Rho GTPases, consequently inactivating them. This helps regulate the dynamic activities of Rho GTPases and controls cellular processes.
Yes, ARHGAP4 has been implicated in regulating cell adhesion and junction dynamics. Through its modulation of Rho GTPases, ARHGAP4 can participate in the regulation of actin cytoskeleton dynamics, which is involved in cell adhesion and formation of cell-cell junctions. Dysregulation of ARHGAP4 may disrupt these processes and contribute to altered cell adhesion and junction dynamics.
Yes, genetic variations and mutations in the ARHGAP4 gene have been reported. Some mutations may lead to altered protein function or expression levels, thereby contributing to the development of certain diseases or disorders.
Several proteins have been identified as interacting partners of ARHGAP4, including members of the Rho GTPase family, such as RhoA and Rac1. ARHGAP4 can also interact with other proteins involved in cytoskeletal regulation, cell adhesion, and signaling pathways, such as p190RhoGAP, p115RhoGEF, and p120-catenin. These interactions suggest that ARHGAP4 can function in complex regulatory networks and participate in multiple cellular processes.
Yes, ARHGAP4 has been implicated in several cellular processes, such as cell migration, cell polarity, and axon guidance. It is also involved in regulating the actin cytoskeleton, which is essential for various cellular functions.
While the direct involvement of ARHGAP4 in neurodegenerative diseases is not well-established, studies have implicated aberrant Rho GTPase signaling in neurodegenerative processes. Given ARHGAP4's role in regulating Rho GTPases, it is an area of research interest to explore its potential contribution to neurodegeneration and identify any therapeutic opportunities.
Yes, ARHGAP4 interacts with several proteins. For example, it has been shown to interact with the E3 ubiquitin ligase Nedd4-2, which controls the degradation and stability of ARHGAP4. It has also been reported to interact with other Rho GTPases, effector proteins, and scaffold proteins involved in regulating cellular processes.
At present, there are no specific inhibitors or activators identified for ARHGAP4. However, since ARHGAP4 acts as a negative regulator of Rho GTPases, modulating the activity or expression of these GTPases indirectly affects the function of ARHGAP4. Therefore, compounds targeting Rho GTPase signaling pathways could indirectly influence ARHGAP4 activity.
There is limited information available regarding the role of ARHGAP4 in immune cell function. However, since ARHGAP4 is expressed in immune cells, it is likely to play a role in regulating immune cell processes such as migration, adhesion, and signaling. Further studies are needed to determine the specific contributions of ARHGAP4 to immune cell function and immune-related diseases.
ARHGAP4 is widely expressed in various cell types and tissues throughout the body. Its expression can vary depending on the developmental stage and tissue context.
Yes, ARHGAP4 can be regulated by various cellular signals and stimuli. For example, growth factors, cytokines, and extracellular matrix components can influence its expression and activity. Additionally, cellular stress, such as oxidative stress or DNA damage, can also affect ARHGAP4 regulation.
Customer Reviews (10)
Write a reviewThe protein bands detected were exceptionally distinct, enabling easy interpretation and accurate analysis of protein expression patterns.
To summarize, the ARHGAP4 protein is a highly recommended asset for various research endeavors, including ELISA, protein electron microscopy structure analysis, and Western blotting.
This reliable supply chain management assures that I have uninterrupted access to the protein, allowing me to plan and conduct my experiments without concern for availability issues.
With their assistance, I am confident in overcoming challenges, producing robust results, and advancing our understanding of ARHGAP4 protein and its biological significance.
This level of sensitivity and specificity has streamlined my research and allowed for precise protein characterization.
They ensure a reliable and consistent supply of ARHGAP4 protein, minimizing any potential disruptions in my experimental workflow.
Whether it involves experimental design, protocol optimization, or data analysis, their expertise can help me navigate through complexities, saving valuable time and resources.
They ensure a reliable and consistent supply of ARHGAP4 protein, minimizing any potential disruptions in my experimental workflow.
Its exceptional performance, coupled with its ability to generate clear and precise protein bands, make it an indispensable tool in achieving accurate and reliable results.
The ARHGAP4 protein exhibits a high degree of specificity in various assays, ensuring accurate and reliable results.
Ask a Question for All ARHGAP4 Products
Required fields are marked with *
My Review for All ARHGAP4 Products
Required fields are marked with *
Inquiry Basket