Recombinant Human ARHGAP4, His-tagged
| Cat.No. : | ARHGAP4-26278TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 692-946 of Human ARHGAP4 with an N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 692-946 a.a. |
| Description : | This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNE PELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRR GDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTE KQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEA MGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGK TSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSR GPGAPASPSASHPQGLDTTPKPH |
| Gene Name | ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ] |
| Official Symbol | ARHGAP4 |
| Synonyms | ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4; |
| Gene ID | 393 |
| mRNA Refseq | NM_001164741 |
| Protein Refseq | NP_001158213 |
| MIM | 300023 |
| Uniprot ID | P98171 |
| Chromosome Location | Xq28 |
| Pathway | Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; |
| Function | GTPase activator activity; Rho GTPase activator activity; SH3/SH2 adaptor activity; protein binding; |
| ◆ Recombinant Proteins | ||
| ARHGAP4-9827H | Recombinant Human ARHGAP4, GST-tagged | +Inquiry |
| ARHGAP4-770H | Recombinant Human ARHGAP4 protein, GST-tagged | +Inquiry |
| ARHGAP4-26278TH | Recombinant Human ARHGAP4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGAP4-113HCL | Recombinant Human ARHGAP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP4 Products
Required fields are marked with *
My Review for All ARHGAP4 Products
Required fields are marked with *
