Recombinant Human ARHGAP4, His-tagged

Cat.No. : ARHGAP4-26278TH
Product Overview : Recombinant fragment, corresponding to amino acids 692-946 of Human ARHGAP4 with an N terminal His tag; Predicted MWt 28 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 692-946 a.a.
Description : This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNE PELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRR GDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTE KQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEA MGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGK TSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSR GPGAPASPSASHPQGLDTTPKPH
Gene Name ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ]
Official Symbol ARHGAP4
Synonyms ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4;
Gene ID 393
mRNA Refseq NM_001164741
Protein Refseq NP_001158213
MIM 300023
Uniprot ID P98171
Chromosome Location Xq28
Pathway Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem;
Function GTPase activator activity; Rho GTPase activator activity; SH3/SH2 adaptor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGAP4 Products

Required fields are marked with *

My Review for All ARHGAP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon