"ARHGDIG" Related Products

Expand

Recombinant Human ARHGDIG

Cat.No.: ARHGDIG-26234TH
Product Overview: Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa.
Description: The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).
Protein length: 225 amino acids
Molecular Weight: 50.860kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Primarily expressed in pancreas and brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD
Sequence Similarities: Belongs to the Rho GDI family.
Gene Name: ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ]
Official Symbol: ARHGDIG
Synonyms: ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3;
Gene ID: 398
mRNA Refseq: NM_001176
Protein Refseq: NP_001167
MIM: 602844
Uniprot ID: Q99819
Chromosome Location: 16p13.3
Pathway: G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function: GTPase activator activity; Rho GDP-dissociation inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.