Recombinant Human ARHGDIG

PRODUCTS

Home / Products / Antibody / Recombinant Human ARHGDIG

Recombinant Human ARHGDIG

ARHGDIG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARHGDIG-26234TH
Product Overview : Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa.
Description : The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).
Protein length : 225 amino acids
Molecular Weight : 50.860kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Primarily expressed in pancreas and brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD
Sequence Similarities : Belongs to the Rho GDI family.
Gene Name : ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ]
Official Symbol : ARHGDIG
Synonyms : ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3;
Gene ID : 398
mRNA Refseq : NM_001176
Protein Refseq : NP_001167
MIM : 602844
Uniprot ID : Q99819
Chromosome Location : 16p13.3
Pathway : G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function : GTPase activator activity; Rho GDP-dissociation inhibitor activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.