Recombinant Human ARHGDIG
Cat.No. : | ARHGDIG-26234TH |
Product Overview : | Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843). |
Protein length : | 225 amino acids |
Molecular Weight : | 50.860kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Primarily expressed in pancreas and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD |
Sequence Similarities : | Belongs to the Rho GDI family. |
Gene Name : | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
Official Symbol : | ARHGDIG |
Synonyms : | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; |
Gene ID : | 398 |
mRNA Refseq : | NM_001176 |
Protein Refseq : | NP_001167 |
MIM : | 602844 |
Uniprot ID : | Q99819 |
Chromosome Location : | 16p13.3 |
Pathway : | G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
Function : | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
ARHGDIG-2495H | Recombinant Human ARHGDIG Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIG-617H | Recombinant Human ARHGDIG | +Inquiry |
ARHGDIG-9830H | Recombinant Human ARHGDIG, His-tagged | +Inquiry |
ARHGDIG-11376Z | Recombinant Zebrafish ARHGDIG | +Inquiry |
ARHGDIG-776H | Recombinant Human ARHGDIG protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ARHGDIG-115HCL | Recombinant Human ARHGDIG cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket