Recombinant Human ARHGDIG protein, His-tagged
Cat.No. : | ARHGDIG-9830H |
Product Overview : | Recombinant Human ARHGDIG protein(1-225 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-225 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
Official Symbol | ARHGDIG |
Synonyms | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; rho GDI 3; rho-GDI gamma; RHOGDI-3; |
Gene ID | 398 |
mRNA Refseq | NM_001176 |
Protein Refseq | NP_001167 |
MIM | 602844 |
UniProt ID | Q99819 |
◆ Recombinant Proteins | ||
ARHGDIG-776H | Recombinant Human ARHGDIG protein, GST-tagged | +Inquiry |
ARHGDIG-11376Z | Recombinant Zebrafish ARHGDIG | +Inquiry |
ARHGDIG-9830H | Recombinant Human ARHGDIG protein, His-tagged | +Inquiry |
ARHGDIG-26234TH | Recombinant Human ARHGDIG | +Inquiry |
ARHGDIG-2495H | Recombinant Human ARHGDIG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIG-115HCL | Recombinant Human ARHGDIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIG Products
Required fields are marked with *
My Review for All ARHGDIG Products
Required fields are marked with *
0
Inquiry Basket