Recombinant Human ARID3A

PRODUCTS

Home / Products / Antibody / Recombinant Human ARID3A

Recombinant Human ARID3A

ARID3A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARID3A-28375TH
Product Overview : Recombinant fragment of Human DRIL1 with N terminal proprietary tag; Predicted MW 36.63 kDa.
Description : This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Sequence Similarities : Contains 1 ARID domain.Contains 1 REKLES domain.
Gene Name : ARID3A AT rich interactive domain 3A (BRIGHT-like) [ Homo sapiens ]
Official Symbol : ARID3A
Synonyms : ARID3A; AT rich interactive domain 3A (BRIGHT-like); AT rich interactive domain 3A (BRIGHT like) , dead ringer like 1 (Drosophila) , DRIL1; AT-rich interactive domain-containing protein 3A; BRIGHT;
Gene ID : 1820
mRNA Refseq : NM_005224
Protein Refseq : NP_005215
MIM : 603265
Uniprot ID : Q99856
Chromosome Location : 19p13.3
Pathway : Direct p53 effectors, organism-specific biosystem;
Function : DNA binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.