Recombinant Human ARID3A
Cat.No. : | ARID3A-28375TH |
Product Overview : | Recombinant fragment of Human DRIL1 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed, with highest expression in skeletal muscle, thalamus, and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS |
Sequence Similarities : | Contains 1 ARID domain.Contains 1 REKLES domain. |
Gene Name | ARID3A AT rich interactive domain 3A (BRIGHT-like) [ Homo sapiens ] |
Official Symbol | ARID3A |
Synonyms | ARID3A; AT rich interactive domain 3A (BRIGHT-like); AT rich interactive domain 3A (BRIGHT like) , dead ringer like 1 (Drosophila) , DRIL1; AT-rich interactive domain-containing protein 3A; BRIGHT; |
Gene ID | 1820 |
mRNA Refseq | NM_005224 |
Protein Refseq | NP_005215 |
MIM | 603265 |
Uniprot ID | Q99856 |
Chromosome Location | 19p13.3 |
Pathway | Direct p53 effectors, organism-specific biosystem; |
Function | DNA binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Arid3a-1698M | Recombinant Mouse Arid3a Protein, Myc/DDK-tagged | +Inquiry |
ARID3A-1052HF | Recombinant Full Length Human ARID3A Protein, GST-tagged | +Inquiry |
ARID3A-2254H | Recombinant Human ARID3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARID3A-1911M | Recombinant Mouse ARID3A Protein | +Inquiry |
ARID3A-28375TH | Recombinant Human ARID3A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARID3A-8727HCL | Recombinant Human ARID3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARID3A Products
Required fields are marked with *
My Review for All ARID3A Products
Required fields are marked with *
0
Inquiry Basket