Recombinant Human ARID3A

Cat.No. : ARID3A-28375TH
Product Overview : Recombinant fragment of Human DRIL1 with N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Sequence Similarities : Contains 1 ARID domain.Contains 1 REKLES domain.
Gene Name ARID3A AT rich interactive domain 3A (BRIGHT-like) [ Homo sapiens ]
Official Symbol ARID3A
Synonyms ARID3A; AT rich interactive domain 3A (BRIGHT-like); AT rich interactive domain 3A (BRIGHT like) , dead ringer like 1 (Drosophila) , DRIL1; AT-rich interactive domain-containing protein 3A; BRIGHT;
Gene ID 1820
mRNA Refseq NM_005224
Protein Refseq NP_005215
MIM 603265
Uniprot ID Q99856
Chromosome Location 19p13.3
Pathway Direct p53 effectors, organism-specific biosystem;
Function DNA binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARID3A Products

Required fields are marked with *

My Review for All ARID3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon