Recombinant Human ARL5A, His-tagged
| Cat.No. : | ARL5A-26181TH |
| Product Overview : | Recombinant full length Human ARL5A with an N terminal His tag; 203 amino acids with tag, Predicted MWt 23.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 179 amino acids |
| Description : | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. |
| Conjugation : | HIS |
| Molecular Weight : | 23.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR |
| Gene Name | ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ] |
| Official Symbol | ARL5A |
| Synonyms | ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A; |
| Gene ID | 26225 |
| mRNA Refseq | NM_001037174 |
| Protein Refseq | NP_001032251 |
| MIM | 608960 |
| Uniprot ID | Q9Y689 |
| Chromosome Location | 2q23.3 |
| Function | GTP binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| ARL5A-26181TH | Recombinant Human ARL5A, His-tagged | +Inquiry |
| Arl5a-3218R | Recombinant Rat Arl5a, His-tagged | +Inquiry |
| ARL5-814H | Recombinant Human ARL5 protein, GST-tagged | +Inquiry |
| ARL5A-3819H | Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARL5A-488Z | Recombinant Zebrafish ARL5A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL5A-8710HCL | Recombinant Human ARL5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5A Products
Required fields are marked with *
My Review for All ARL5A Products
Required fields are marked with *



