"ARL5A" Related Products

Expand

Recombinant Human ARL5A, His-tagged

Cat.No.: ARL5A-26181TH
Product Overview: Recombinant full length Human ARL5A with an N terminal His tag; 203 amino acids with tag, Predicted MWt 23.3 kDa.
Description: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Protein length: 179 amino acids
Conjugation: HIS
Molecular Weight: 23.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Gene Name: ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ]
Official Symbol: ARL5A
Synonyms: ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A;
Gene ID: 26225
mRNA Refseq: NM_001037174
Protein Refseq: NP_001032251
MIM: 608960
Uniprot ID: Q9Y689
Chromosome Location: 2q23.3
Function: GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.