"ARL5A" Related Products

Expand

Recombinant Human ARL5A, His-tagged

Cat.No.: ARL5A-26181TH
Product Overview: Recombinant full length Human ARL5A with an N terminal His tag; 203 amino acids with tag, Predicted MWt 23.3 kDa.
Description: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Protein length: 179 amino acids
Conjugation: HIS
Molecular Weight: 23.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Gene Name: ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ]
Official Symbol: ARL5A
Synonyms: ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A;
Gene ID: 26225
mRNA Refseq: NM_001037174
Protein Refseq: NP_001032251
MIM: 608960
Uniprot ID: Q9Y689
Chromosome Location: 2q23.3
Function: GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.