Recombinant Human ARL5A, His-tagged

Cat.No. : ARL5A-26181TH
Product Overview : Recombinant full length Human ARL5A with an N terminal His tag; 203 amino acids with tag, Predicted MWt 23.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 179 amino acids
Description : The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Conjugation : HIS
Molecular Weight : 23.300kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Gene Name ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ]
Official Symbol ARL5A
Synonyms ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A;
Gene ID 26225
mRNA Refseq NM_001037174
Protein Refseq NP_001032251
MIM 608960
Uniprot ID Q9Y689
Chromosome Location 2q23.3
Function GTP binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL5A Products

Required fields are marked with *

My Review for All ARL5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon