Recombinant Human ARL5B

PRODUCTS

Home / Products / Antibody / Recombinant Human ARL5B

Recombinant Human ARL5B

ARL5B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARL5B-26182TH
Product Overview : Recombinant full length Human ARL5B expressed in Saccharomyces cerevisiae; amino acids 1-179, 179 amino acids, MWt 20.4 kDa. Protein is tagged with 26 kDa proprietary tag.
Description : ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNE VVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWN TYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQS CCALTGEGLCQGLEWMTSRIGVR
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name : ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
Official Symbol : ARL5B
Synonyms : ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B;
Gene ID : 221079
mRNA Refseq : NM_178815
Protein Refseq : NP_848930
MIM : 608909
Uniprot ID : Q96KC2
Chromosome Location : 10p13
Function : GTP binding; nucleotide binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.