Recombinant Human ARL5B
Cat.No. : | ARL5B-26182TH |
Product Overview : | Recombinant full length Human ARL5B expressed in Saccharomyces cerevisiae; amino acids 1-179, 179 amino acids, MWt 20.4 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-179 a.a. |
Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNE VVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWN TYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQS CCALTGEGLCQGLEWMTSRIGVR |
Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
Full Length : | Full L. |
Gene Name | ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ] |
Official Symbol | ARL5B |
Synonyms | ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B; |
Gene ID | 221079 |
mRNA Refseq | NM_178815 |
Protein Refseq | NP_848930 |
MIM | 608909 |
Uniprot ID | Q96KC2 |
Chromosome Location | 10p13 |
Function | GTP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
ARL5B-26182TH | Recombinant Human ARL5B | +Inquiry |
ARL5B-9860H | Recombinant Human ARL5B, GST-tagged | +Inquiry |
ARL5B-1424HF | Recombinant Full Length Human ARL5B Protein, GST-tagged | +Inquiry |
ARL5B-3903C | Recombinant Chicken ARL5B | +Inquiry |
ARL8-822H | Recombinant Human ARL8 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL5B-8709HCL | Recombinant Human ARL5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5B Products
Required fields are marked with *
My Review for All ARL5B Products
Required fields are marked with *