Recombinant Human ARL5B

• Cat.No.: ARL5B-26182TH
• Product Overview: Recombinant full length Human ARL5B expressed in Saccharomyces cerevisiae; amino acids 1-179, 179 amino acids, MWt 20.4 kDa. Protein is tagged with 26 kDa proprietary tag.

Specification

• Species: Human
• Tag: Non
• Protein Length: 1-179 a.a.
• Description: ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNE VVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWN TYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQS CCALTGEGLCQGLEWMTSRIGVR
• Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
• Full Length: Full L.

Gene Information

• Gene Name: ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
• Official Symbol: ARL5B
• Synonyms: ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B
• Gene ID: 221079
• mRNA Refseq: NM_178815
• Protein Refseq: NP_848930
• MIM: 608909
• Uniprot ID: Q96KC2
• Chromosome Location: 10p13
• Function: GTP binding; nucleotide binding