Recombinant Human ARL5B protein, GST-tagged
| Cat.No. : | ARL5B-815H |
| Product Overview : | Human ARL5B full-length ORF ( NP_848930.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010] |
| Molecular Mass : | 46.8 kDa |
| AA Sequence : | MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ] |
| Official Symbol | ARL5B |
| Synonyms | ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B; ADP-ribosylation factor-like 8; ADP-ribosylation-like factor 8; ADP-ribosylation factor-like protein 8; ARL8; |
| Gene ID | 221079 |
| mRNA Refseq | NM_178815 |
| Protein Refseq | NP_848930 |
| MIM | 608909 |
| UniProt ID | Q96KC2 |
| ◆ Recombinant Proteins | ||
| ARL5B-3614H | Recombinant Human ARL5B, His-tagged | +Inquiry |
| ARL5B-3903C | Recombinant Chicken ARL5B | +Inquiry |
| ARL8-822H | Recombinant Human ARL8 protein, GST-tagged | +Inquiry |
| ARL5B-815H | Recombinant Human ARL5B protein, GST-tagged | +Inquiry |
| ARL5B-1424HF | Recombinant Full Length Human ARL5B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL5B-8709HCL | Recombinant Human ARL5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5B Products
Required fields are marked with *
My Review for All ARL5B Products
Required fields are marked with *
