Recombinant Human ARL5B, His-tagged

Cat.No. : ARL5B-26184TH
Product Overview : Recombinant full-length Human ARL5B with a N terminal His tag; 199aa, 23 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 299 amino acids
Description : ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
Conjugation : HIS
Molecular Weight : 22.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
Official Symbol ARL5B
Synonyms ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B;
Gene ID 221079
mRNA Refseq NM_178815
Protein Refseq NP_848930
MIM 608909
Uniprot ID Q96KC2
Chromosome Location 10p13
Function GTP binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL5B Products

Required fields are marked with *

My Review for All ARL5B Products

Required fields are marked with *

0
cart-icon