Recombinant Human ARL5B, His-tagged
| Cat.No. : | ARL5B-26184TH |
| Product Overview : | Recombinant full-length Human ARL5B with a N terminal His tag; 199aa, 23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 299 amino acids |
| Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases. |
| Conjugation : | HIS |
| Molecular Weight : | 22.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
| Gene Name | ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ] |
| Official Symbol | ARL5B |
| Synonyms | ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B; |
| Gene ID | 221079 |
| mRNA Refseq | NM_178815 |
| Protein Refseq | NP_848930 |
| MIM | 608909 |
| Uniprot ID | Q96KC2 |
| Chromosome Location | 10p13 |
| Function | GTP binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| ARL8-822H | Recombinant Human ARL8 protein, GST-tagged | +Inquiry |
| ARL5B-815H | Recombinant Human ARL5B protein, GST-tagged | +Inquiry |
| ARL5B-26182TH | Recombinant Human ARL5B | +Inquiry |
| ARL5B-3614H | Recombinant Human ARL5B, His-tagged | +Inquiry |
| ARL5B-3903C | Recombinant Chicken ARL5B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL5B-8709HCL | Recombinant Human ARL5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5B Products
Required fields are marked with *
My Review for All ARL5B Products
Required fields are marked with *



