"ARL5B" Related Products

Expand

Recombinant Human ARL5B, His-tagged

Cat.No.: ARL5B-26184TH
Product Overview: Recombinant full-length Human ARL5B with a N terminal His tag; 199aa, 23 kDa.
Description: ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
Protein length: 299 amino acids
Conjugation: HIS
Molecular Weight: 22.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
Gene Name: ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
Official Symbol: ARL5B
Synonyms: ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B;
Gene ID: 221079
mRNA Refseq: NM_178815
Protein Refseq: NP_848930
MIM: 608909
Uniprot ID: Q96KC2
Chromosome Location: 10p13
Function: GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.