"ARL5B" Related Products

Expand

Recombinant Human ARL5B, His-tagged

Cat.No. : ARL5B-26184TH
Product Overview : Recombinant full-length Human ARL5B with a N terminal His tag; 199aa, 23 kDa.
Description : ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.
Protein length : 299 amino acids
Conjugation : HIS
Molecular Weight : 22.500kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name : ARL5B ADP-ribosylation factor-like 5B [ Homo sapiens ]
Official Symbol : ARL5B
Synonyms : ARL5B; ADP-ribosylation factor-like 5B; ADP ribosylation factor like 8 , ARL8; ADP-ribosylation factor-like protein 5B;
Gene ID : 221079
mRNA Refseq : NM_178815
Protein Refseq : NP_848930
MIM : 608909
Uniprot ID : Q96KC2
Chromosome Location : 10p13
Function : GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.