Recombinant Human ARSA

• Cat.No.: ARSA-26265TH
• Product Overview: Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa.

Specification

• Description: The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA
• Sequence Similarities: Belongs to the sulfatase family.

Gene Information

• Gene Name: ARSA arylsulfatase A [ Homo sapiens ]
• Official Symbol: ARSA
• Synonyms: ARSA; arylsulfatase A; metachromatic leucodystrophy
• Gene ID: 410
• mRNA Refseq: NM_000487
• Protein Refseq: NP_000478
• MIM: 607574
• Uniprot ID: P15289
• Chromosome Location: 22q13.31-qter
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem
• Function: arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity