"ARSA" Related Products

Expand
Expand

Recombinant Human ARSA

Cat.No.: ARSA-26265TH
Product Overview: Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa.
Description: The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA
Sequence Similarities: Belongs to the sulfatase family.
Gene Name: ARSA arylsulfatase A [ Homo sapiens ]
Official Symbol: ARSA
Synonyms: ARSA; arylsulfatase A; metachromatic leucodystrophy;
Gene ID: 410
mRNA Refseq: NM_000487
Protein Refseq: NP_000478
MIM: 607574
Uniprot ID: P15289
Chromosome Location: 22q13.31-qter
Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem;
Function: arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.