Recombinant Human ARSA
| Cat.No. : | ARSA-26265TH |
| Product Overview : | Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA |
| Sequence Similarities : | Belongs to the sulfatase family. |
| Gene Name | ARSA arylsulfatase A [ Homo sapiens ] |
| Official Symbol | ARSA |
| Synonyms | ARSA; arylsulfatase A; metachromatic leucodystrophy; |
| Gene ID | 410 |
| mRNA Refseq | NM_000487 |
| Protein Refseq | NP_000478 |
| MIM | 607574 |
| Uniprot ID | P15289 |
| Chromosome Location | 22q13.31-qter |
| Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
| Function | arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity; |
| ◆ Recombinant Proteins | ||
| ARSA-861H | Recombinant Human ARSA protein, GST-tagged | +Inquiry |
| ARSA-2826H | Recombinant Human ARSA Protein, MYC/DDK-tagged | +Inquiry |
| ARSA-2206Z | Recombinant Zebrafish ARSA | +Inquiry |
| ARSA-14H | Active Recombinant Human ARSA Protein (21-509), C-His-tagged | +Inquiry |
| ARSA-382H | Recombinant Human ARSA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
| ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSA Products
Required fields are marked with *
My Review for All ARSA Products
Required fields are marked with *
