Recombinant Human ASAH1

Cat.No. : ASAH1-26424TH
Product Overview : Recombinant fragment of Human ASAH1 with an N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Broadly expressed with highest expression in heart.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
Sequence Similarities : Belongs to the acid ceramidase family.
Gene Name ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1 [ Homo sapiens ]
Official Symbol ASAH1
Synonyms ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase) 1; ASAH, N acylsphingosine amidohydrolase (acid ceramidase); acid ceramidase; AC; FLJ21558; PHP32;
Gene ID 427
mRNA Refseq NM_001127505
Protein Refseq NP_001120977
MIM 613468
Uniprot ID Q13510
Chromosome Location 8p22
Pathway Ceramide signaling pathway, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolic pathways, organism-specific biosystem; Signal Transduction of S1P Receptor, organism-specific biosystem;
Function catalytic activity; ceramidase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASAH1 Products

Required fields are marked with *

My Review for All ASAH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon