Recombinant Human ASAH1
Cat.No. : | ASAH1-26424TH |
Product Overview : | Recombinant fragment of Human ASAH1 with an N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Broadly expressed with highest expression in heart. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD |
Sequence Similarities : | Belongs to the acid ceramidase family. |
Gene Name | ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1 [ Homo sapiens ] |
Official Symbol | ASAH1 |
Synonyms | ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase) 1; ASAH, N acylsphingosine amidohydrolase (acid ceramidase); acid ceramidase; AC; FLJ21558; PHP32; |
Gene ID | 427 |
mRNA Refseq | NM_001127505 |
Protein Refseq | NP_001120977 |
MIM | 613468 |
Uniprot ID | Q13510 |
Chromosome Location | 8p22 |
Pathway | Ceramide signaling pathway, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolic pathways, organism-specific biosystem; Signal Transduction of S1P Receptor, organism-specific biosystem; |
Function | catalytic activity; ceramidase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
ASAH1-213H | Recombinant Human N-acylsphingosine amidohydrolase 1 Protein, His&Flag tagged | +Inquiry |
ASAH1-470R | Recombinant Rat ASAH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASAH1-878H | Recombinant Human ASAH1 protein, GST-tagged | +Inquiry |
Asah1-2473M | Recombinant Mouse Asah1 protein, His-SUMO & Myc-tagged | +Inquiry |
ASAH1-0471H | Recombinant Human ASAH1 Protein (Gln22-Trp395), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASAH1 Products
Required fields are marked with *
My Review for All ASAH1 Products
Required fields are marked with *
0
Inquiry Basket