"ASGR1" Related Products

Expand
Expand

Recombinant Human ASGR1, His-tagged

Cat.No.: ASGR1-26517TH
Product Overview: Recombinant fragment, corresponding to amino acids 55-291 of Human Asialoglycoprotein Receptor 1 with an N terminal His tag; MWt 32kDa.
Description: This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQ GGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVS DLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSR SGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPV NTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHG LGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQ EPPLL
Gene Name: ASGR1 asialoglycoprotein receptor 1 [ Homo sapiens ]
Official Symbol: ASGR1
Synonyms: ASGR1; asialoglycoprotein receptor 1; CLEC4H1;
Gene ID: 432
mRNA Refseq: NM_001197216
Protein Refseq: NP_001184145
MIM: 108360
Uniprot ID: P07306
Chromosome Location: 17p13-p11
Function: asialoglycoprotein receptor activity; metal ion binding; protein binding; protein homodimerization activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.