Recombinant Human ATP4B

• Cat.No.: ATP4B-29416TH
• Product Overview: Recombinant fragment of Human Hydrogen Potassium ATPase Beta with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTW ADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPN HTKFSCKFTADMLQNCSGLADPNFGFEEGK

Gene Information

• Gene Name: ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
• Official Symbol: ATP4B
• Synonyms: ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B
• Gene ID: 496
• mRNA Refseq: NM_000705
• Protein Refseq: NP_000696
• MIM: 137217
• Uniprot ID: P51164
• Chromosome Location: 13q34
• Pathway: Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem
• Function: hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity