"ATP4B" Related Products

Expand
Expand

Recombinant Human ATP4B

Cat.No.: ATP4B-29416TH
Product Overview: Recombinant fragment of Human Hydrogen Potassium ATPase Beta with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
Description: The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTW ADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPN HTKFSCKFTADMLQNCSGLADPNFGFEEGK
Gene Name: ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
Official Symbol: ATP4B
Synonyms: ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B;
Gene ID: 496
mRNA Refseq: NM_000705
Protein Refseq: NP_000696
MIM: 137217
Uniprot ID: P51164
Chromosome Location: 13q34
Pathway: Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem;
Function: hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.