Recombinant Human ATP4B Protein (58-291 aa), His-tagged
Cat.No. : | ATP4B-1337H |
Product Overview : | Recombinant Human ATP4B Protein (58-291 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 58-291 aa |
Description : | Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.6 kDa |
AA Sequence : | CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP4B |
Synonyms | ATP4B; ATP6B; proton pump beta chain; |
Gene ID | 496 |
mRNA Refseq | NM_000705 |
Protein Refseq | NP_000696 |
MIM | 137217 |
UniProt ID | P51164 |
◆ Recombinant Proteins | ||
RFL-2592CF | Recombinant Full Length Dog Potassium-Transporting Atpase Subunit Beta(Atp4B) Protein, His-Tagged | +Inquiry |
ATP4B-866R | Recombinant Rat ATP4B Protein | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
RFL-20900RF | Recombinant Full Length Rat Potassium-Transporting Atpase Subunit Beta(Atp4B) Protein, His-Tagged | +Inquiry |
ATP4B-2435H | Recombinant Human ATP4B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *