Recombinant Human ATP4B Protein (58-291 aa), His-tagged

Cat.No. : ATP4B-1337H
Product Overview : Recombinant Human ATP4B Protein (58-291 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 58-291 aa
Description : Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.6 kDa
AA Sequence : CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
Official Symbol ATP4B
Synonyms ATP4B; ATP6B; proton pump beta chain;
Gene ID 496
mRNA Refseq NM_000705
Protein Refseq NP_000696
MIM 137217
UniProt ID P51164

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP4B Products

Required fields are marked with *

My Review for All ATP4B Products

Required fields are marked with *

0
cart-icon