Recombinant Human ATP4B Protein (58-291 aa), His-tagged
| Cat.No. : | ATP4B-1337H |
| Product Overview : | Recombinant Human ATP4B Protein (58-291 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 58-291 aa |
| Description : | Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.6 kDa |
| AA Sequence : | CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
| Official Symbol | ATP4B |
| Synonyms | ATP4B; ATP6B; proton pump beta chain; |
| Gene ID | 496 |
| mRNA Refseq | NM_000705 |
| Protein Refseq | NP_000696 |
| MIM | 137217 |
| UniProt ID | P51164 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *



