Recombinant Human ATP4B protein, N/A-tagged
Cat.No. : | ATP4B-2566H |
Product Overview : | Recombinant Human ATP4B protein(P51164)(58-291aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 58-291aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP4B |
Synonyms | ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; proton pump beta chain; gastric H+/K+ ATPase beta subunit; gastric H(+)/K(+) ATPase subunit beta; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; ATPase, H+/K+ transporting, beta polypeptide; |
Gene ID | 496 |
mRNA Refseq | NM_000705 |
Protein Refseq | NP_000696 |
MIM | 137217 |
UniProt ID | P51164 |
◆ Recombinant Proteins | ||
ATP4B-522R | Recombinant Rat ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP4B-2943H | Recombinant Human ATP4B protein, GST-tagged | +Inquiry |
ATP4B-858M | Recombinant Mouse ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP4B-2128M | Recombinant Mouse ATP4B Protein | +Inquiry |
ATP4B-2435H | Recombinant Human ATP4B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *