Recombinant Human BCKDK, His-tagged BCKDK-27438TH

Recombinant Human BCKDK, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BCKDK, His-tagged

Recombinant Human BCKDK, His-tagged

BCKDK Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BCKDK-27438TH
Product Overview : Recombinant fragment, corresponding to amino acids 39-412 of Human BCKDH kinase with an N terminal His tag; Predicted MWt 44 kDa.
Description : Catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex,the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. Key enzyme that regulate the activity state of the BCKD complex.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 109 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYA GRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFII GCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQL VRQLLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDK TLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIE KWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLD YILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVD LIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRIS PLFGHLDMHSGAQSGPMHGFGFGLPTSRAYAEYLGGSLQL QSLQGIGTDVYLRLRHIDGREESFRI
Sequence Similarities : Belongs to the PDK/BCKDK protein kinase family.Contains 1 histidine kinase domain.
Gene Name : BCKDK branched chain ketoacid dehydrogenase kinase [ Homo sapiens ]
Official Symbol : BCKDK
Synonyms : BCKDK; branched chain ketoacid dehydrogenase kinase; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial;
Gene ID : 10295
mRNA Refseq : NM_005881
Protein Refseq : NP_005872
Uniprot ID : O14874
Chromosome Location : 16p11.2
Function : ATP binding; ATP binding; [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity; kinase activity; kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy