Recombinant Human BCKDK, His-tagged
| Cat.No. : | BCKDK-27438TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 39-412 of Human BCKDH kinase with an N terminal His tag; Predicted MWt 44 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 39-412 a.a. | 
| Description : | Catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex,the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. Key enzyme that regulate the activity state of the BCKD complex. | 
| Conjugation : | HIS | 
| Tissue specificity : | Ubiquitous. | 
| Form : | Lyophilised:Reconstitute with 109 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | HVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYA GRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFII GCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQL VRQLLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDK TLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIE KWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLD YILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVD LIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRIS PLFGHLDMHSGAQSGPMHGFGFGLPTSRAYAEYLGGSLQL QSLQGIGTDVYLRLRHIDGREESFRI | 
| Sequence Similarities : | Belongs to the PDK/BCKDK protein kinase family.Contains 1 histidine kinase domain. | 
| Gene Name | BCKDK branched chain ketoacid dehydrogenase kinase [ Homo sapiens ] | 
| Official Symbol | BCKDK | 
| Synonyms | BCKDK; branched chain ketoacid dehydrogenase kinase; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; | 
| Gene ID | 10295 | 
| mRNA Refseq | NM_005881 | 
| Protein Refseq | NP_005872 | 
| Uniprot ID | O14874 | 
| Chromosome Location | 16p11.2 | 
| Function | ATP binding; ATP binding; [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity; kinase activity; kinase activity; | 
| ◆ Recombinant Proteins | ||
| BCKDK-348R | Recombinant Rhesus Macaque BCKDK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BCKDK-1623HF | Recombinant Full Length Human BCKDK Protein, GST-tagged | +Inquiry | 
| BCKDK-1577HF | Recombinant Full Length Human BCKDK Protein, GST-tagged | +Inquiry | 
| Bckdk-1689R | Recombinant Rat Bckdk protein, His & T7-tagged | +Inquiry | 
| BCKDK-520R | Recombinant Rhesus monkey BCKDK Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BCKDK-8491HCL | Recombinant Human BCKDK 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCKDK Products
Required fields are marked with *
My Review for All BCKDK Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            