Recombinant Human BCKDK Protein, GST-tagged
| Cat.No. : | BCKDK-140H |
| Product Overview : | Human BCKDK partial ORF ( AAH07363, 31 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | STSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCKDK branched chain ketoacid dehydrogenase kinase [ Homo sapiens ] |
| Official Symbol | BCKDK |
| Synonyms | BCKDK; branched chain ketoacid dehydrogenase kinase; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; BCKDHKIN; BCKD-kinase; branched chain alpha-ketoacid dehydrogenase kinase; branched-chain alpha-ketoacid dehydrogenase kinase; |
| Gene ID | 10295 |
| mRNA Refseq | NM_001122957 |
| Protein Refseq | NP_001116429 |
| UniProt ID | O14874 |
| ◆ Recombinant Proteins | ||
| BCKDK-139H | Recombinant Human BCKDK Protein, GST-tagged | +Inquiry |
| BCKDK-613R | Recombinant Rat BCKDK Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCKDK-538HFL | Recombinant Full Length Human BCKDK Protein, C-Flag-tagged | +Inquiry |
| BCKDK-111H | Recombinant Human BCKDK, GST-tagged | +Inquiry |
| Bckdk-1689R | Recombinant Rat Bckdk protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCKDK-8491HCL | Recombinant Human BCKDK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCKDK Products
Required fields are marked with *
My Review for All BCKDK Products
Required fields are marked with *



