Recombinant Human BCKDK Protein, GST-tagged

• Cat.No.: BCKDK-140H
• Product Overview: Human BCKDK partial ORF ( AAH07363, 31 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.53 kDa
• AA Sequence: STSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCKDK branched chain ketoacid dehydrogenase kinase [ Homo sapiens ]
• Official Symbol: BCKDK
• Synonyms: BCKDK; branched chain ketoacid dehydrogenase kinase; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; BCKDHKIN; BCKD-kinase; branched chain alpha-ketoacid dehydrogenase kinase; branched-chain alpha-ketoacid dehydrogenase kinase
• Gene ID: 10295
• mRNA Refseq: NM_001122957
• Protein Refseq: NP_001116429
• UniProt ID: O14874