Recombinant Human BCKDK Protein, GST-tagged

Cat.No. : BCKDK-140H
Product Overview : Human BCKDK partial ORF ( AAH07363, 31 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.53 kDa
AA Sequence : STSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCKDK branched chain ketoacid dehydrogenase kinase [ Homo sapiens ]
Official Symbol BCKDK
Synonyms BCKDK; branched chain ketoacid dehydrogenase kinase; [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; BCKDHKIN; BCKD-kinase; branched chain alpha-ketoacid dehydrogenase kinase; branched-chain alpha-ketoacid dehydrogenase kinase;
Gene ID 10295
mRNA Refseq NM_001122957
Protein Refseq NP_001116429
UniProt ID O14874

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCKDK Products

Required fields are marked with *

My Review for All BCKDK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon