"BIRC5" Related Products

Expand
Expand
Expand

Recombinant Human BIRC5, His-tagged

Cat.No.: BIRC5-31754TH
Product Overview: Recombinant full length Human Survivin with an N terminal His tag ; predicted molecular weight: 18.6 kDa;
Description: This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length: 142 amino acids
Conjugation: HIS
Molecular Weight: 18.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed only in fetal kidney and liver, and to lesser extent, lung and brain. Abundantly expressed in adenocarcinoma (lung, pancreas, colon, breast, and prostate) and in high-grade lymphomas. Also expressed in various renal cell carcinoma cell lines.
Form: Lyophilised:Centrifuge the vial prior to opening. Reconstitute to aconcentration of 0.1-1.0 mg/ml in PBS.
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: None
Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETVKKVRRAIEQLAAMD
Sequence Similarities: Belongs to the IAP family.Contains 1 BIR repeat.
Gene Name: BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens ]
Official Symbol: BIRC5
Synonyms: BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4 , baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha;
Gene ID: 332
mRNA Refseq: NM_001012270
Protein Refseq: NP_001012270
MIM: 603352
Uniprot ID: O15392
Chromosome Location: 17q25.3
Pathway: Apoptosis, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Colorectal cancer, organism-specific biosystem;
Function: Ran GTPase binding; chaperone binding; cobalt ion binding; cofactor binding; cysteine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.