Recombinant Human BIRC5 Protein, His tagged

Cat.No. : BIRC5-31754TH
Product Overview : Recombinant Human BIRC5 protein (1-142 aa) with His tag was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-142 aa
Description : This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 19 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.11 mg/mL by BCA
Gene Name BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens (human) ]
Official Symbol BIRC5
Synonyms BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4, baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1
Gene ID 332
mRNA Refseq NM_001012270
Protein Refseq NP_001012270
MIM 603352
UniProt ID O15392

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BIRC5 Products

Required fields are marked with *

My Review for All BIRC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon