Recombinant Human BNIP1
Cat.No. : | BNIP1-26754TH |
Product Overview : | Recombinant full length Human BNIP1 with N terminal proprietary tag. Predicted MW 50.49 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini. |
Protein length : | 228 amino acids |
Molecular Weight : | 50.490kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSAL TELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQE VENHKKQMLSNQASWRKANLTCKI |
Sequence Similarities : | Belongs to the SEC20 family. |
Gene Name : | BNIP1 BCL2/adenovirus E1B 19kDa interacting protein 1 [ Homo sapiens ] |
Official Symbol : | BNIP1 |
Synonyms : | BNIP1; BCL2/adenovirus E1B 19kDa interacting protein 1; BCL2/adenovirus E1B 19kD interacting protein 1; vesicle transport protein SEC20; Nip1; SEC20; |
Gene ID : | 662 |
mRNA Refseq : | NM_001205 |
Protein Refseq : | NP_001196 |
MIM : | 603291 |
Uniprot ID : | Q12981 |
Chromosome Location : | 5q33-q34 |
Pathway : | SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
BNIP1-658R | Recombinant Rat BNIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BNIP1-1061M | Recombinant Mouse BNIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BNIP1-10260H | Recombinant Human BNIP1, GST-tagged | +Inquiry |
BNIP1-2446M | Recombinant Mouse BNIP1 Protein | +Inquiry |
BNIP1-1000R | Recombinant Rat BNIP1 Protein | +Inquiry |
◆ Lysates | ||
BNIP1-8426HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
BNIP1-8425HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket