Recombinant Human BNIP1

Cat.No. : BNIP1-26754TH
Product Overview : Recombinant full length Human BNIP1 with N terminal proprietary tag. Predicted MW 50.49 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 228 amino acids
Description : This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini.
Molecular Weight : 50.490kDa inclusive of tags
Tissue specificity : Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSAL TELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQE VENHKKQMLSNQASWRKANLTCKI
Sequence Similarities : Belongs to the SEC20 family.
Gene Name BNIP1 BCL2/adenovirus E1B 19kDa interacting protein 1 [ Homo sapiens ]
Official Symbol BNIP1
Synonyms BNIP1; BCL2/adenovirus E1B 19kDa interacting protein 1; BCL2/adenovirus E1B 19kD interacting protein 1; vesicle transport protein SEC20; Nip1; SEC20;
Gene ID 662
mRNA Refseq NM_001205
Protein Refseq NP_001196
MIM 603291
Uniprot ID Q12981
Chromosome Location 5q33-q34
Pathway SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BNIP1 Products

Required fields are marked with *

My Review for All BNIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon