Recombinant Human BNIP1 protein, His-tagged
Cat.No. : | BNIP1-6755H |
Product Overview : | Recombinant Human BNIP1 protein(1-228 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-228 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BNIP1 BCL2/adenovirus E1B 19kDa interacting protein 1 [ Homo sapiens ] |
Official Symbol | BNIP1 |
Synonyms | BNIP1; BCL2/adenovirus E1B 19kDa interacting protein 1; BCL2/adenovirus E1B 19kD interacting protein 1; vesicle transport protein SEC20; Nip1; SEC20; transformation-related gene 8 protein; BCL2/adenovirus E1B 19 kDa protein-interacting protein 1; NIP1; TRG-8; |
Gene ID | 662 |
mRNA Refseq | NM_001205 |
Protein Refseq | NP_001196 |
MIM | 603291 |
UniProt ID | Q12981 |
◆ Recombinant Proteins | ||
BNIP1-10260H | Recombinant Human BNIP1, GST-tagged | +Inquiry |
BNIP1-6755H | Recombinant Human BNIP1 protein, His-tagged | +Inquiry |
BNIP1-26754TH | Recombinant Human BNIP1 | +Inquiry |
BNIP1-1000R | Recombinant Rat BNIP1 Protein | +Inquiry |
BNIP1-1061M | Recombinant Mouse BNIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP1-8426HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
BNIP1-8425HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP1 Products
Required fields are marked with *
My Review for All BNIP1 Products
Required fields are marked with *