"BUB1B" Related Products

Expand

Recombinant Human BUB1B

Cat.No.: BUB1B-27105TH
Product Overview: Recombinant full length Human BubR1 with a proprietary N terminal tag: predicted molecular weight 141.61 kDa.
Description: This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
Protein length: 1050 amino acids
Molecular Weight: 141.610kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAE EYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENAD EASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLE HRPRGNTASLIAVPAVLPSFTPYVEETAQQPVMTPCKIEP SINHILSTRKPGKEEGDSLQRVQSHQQASEEKKEKMMYCK EKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRA EMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPH SKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT ICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLP EEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREAT HSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIE LGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQP VPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVH GDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRI LNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGK LTSPGALLFQ
Gene Name: BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ]
Official Symbol: BUB1B
Synonyms: BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1;
Gene ID: 701
mRNA Refseq: NM_001211
Protein Refseq: NP_001202
MIM: 602860
Uniprot ID: O60566
Chromosome Location: 15q15
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.