Recombinant Human BUB1B BUB1B-27105TH

Recombinant Human BUB1B

PRODUCTS

Home / Products / Recombinant Human BUB1B

Recombinant Human BUB1B

BUB1B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BUB1B-27105TH
Product Overview : Recombinant full length Human BubR1 with a proprietary N terminal tag: predicted molecular weight 141.61 kDa.
Description : This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
Protein length : 1050 amino acids
Molecular Weight : 141.610kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAE EYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENAD EASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLE HRPRGNTASLIAVPAVLPSFTPYVEETAQQPVMTPCKIEP SINHILSTRKPGKEEGDSLQRVQSHQQASEEKKEKMMYCK EKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRA EMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPH SKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT ICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLP EEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREAT HSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIE LGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQP VPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVH GDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRV QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRI LNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGK LTSPGALLFQ
Gene Name : BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ]
Official Symbol : BUB1B
Synonyms : BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1;
Gene ID : 701
mRNA Refseq : NM_001211
Protein Refseq : NP_001202
MIM : 602860
Uniprot ID : O60566
Chromosome Location : 15q15
Pathway : APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function : ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy