Recombinant Human CACNA1H, His-tagged CACNA1H-26604TH

Recombinant Human CACNA1H, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CACNA1H, His-tagged

Recombinant Human CACNA1H, His-tagged

CACNA1H Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CACNA1H-26604TH
Product Overview : Recombinant fragment, corresponding to amino acids 2027-2347 of Human CACNA1H with N terminal His tag; 321 amino acids, 57kDa.
Description : This gene encodes a T-type member of the alpha-1 subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants, encoding different isoforms, have been characterized for the gene described here. Studies suggest certain mutations in this gene lead to childhood absence epilepsy (CAE).
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 111 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DTLDPAEPGEKTPVRPVTQGGSLQSPPRSPRPASVRTRKH TFGQRCVSSRPAAPGGEEAEASDPADEEVSHITSSACP WQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRA DEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMS PPCISVEPPAEDEGSARPSAAEGGSTTLRRRTPSCEAT PHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSF AFEPLDLGVPSGDPFLDGSHSVTPESRASSSGAIVPLE PPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPSAT PAPGGGADDPV
Gene Name : CACNA1H calcium channel, voltage-dependent, T type, alpha 1H subunit [ Homo sapiens ]
Official Symbol : CACNA1H
Synonyms : CACNA1H; calcium channel, voltage-dependent, T type, alpha 1H subunit; voltage-dependent T-type calcium channel subunit alpha-1H; Cav3.2;
Gene ID : 8912
mRNA Refseq : NM_001005407
Protein Refseq : NP_001005407
MIM : 607904
Uniprot ID : O95180
Chromosome Location : 16p13.3
Pathway : Axon guidance, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;
Function : low voltage-gated calcium channel activity; voltage-gated ion channel activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy