Recombinant Human CACNA1H, His-tagged

Cat.No. : CACNA1H-26604TH
Product Overview : Recombinant fragment, corresponding to amino acids 2027-2347 of Human CACNA1H with N terminal His tag; 321 amino acids, 57kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2027-2347 a.a.
Description : This gene encodes a T-type member of the alpha-1 subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants, encoding different isoforms, have been characterized for the gene described here. Studies suggest certain mutations in this gene lead to childhood absence epilepsy (CAE).
Conjugation : HIS
Form : Lyophilised:Reconstitute with 111 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DTLDPAEPGEKTPVRPVTQGGSLQSPPRSPRPASVRTRKH TFGQRCVSSRPAAPGGEEAEASDPADEEVSHITSSACP WQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRA DEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMS PPCISVEPPAEDEGSARPSAAEGGSTTLRRRTPSCEAT PHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSF AFEPLDLGVPSGDPFLDGSHSVTPESRASSSGAIVPLE PPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPSAT PAPGGGADDPV
Gene Name CACNA1H calcium channel, voltage-dependent, T type, alpha 1H subunit [ Homo sapiens ]
Official Symbol CACNA1H
Synonyms CACNA1H; calcium channel, voltage-dependent, T type, alpha 1H subunit; voltage-dependent T-type calcium channel subunit alpha-1H; Cav3.2;
Gene ID 8912
mRNA Refseq NM_001005407
Protein Refseq NP_001005407
MIM 607904
Uniprot ID O95180
Chromosome Location 16p13.3
Pathway Axon guidance, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;
Function low voltage-gated calcium channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1H Products

Required fields are marked with *

My Review for All CACNA1H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon