Recombinant Human CACNB2
| Cat.No. : | CACNB2-26766TH |
| Product Overview : | Recombinant fragment of Human CACNB2 with N terminal proprietary tag, 35.42kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 89 amino acids |
| Description : | This gene encodes a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene. |
| Molecular Weight : | 35.420kDa inclusive of tags |
| Tissue specificity : | Expressed in all tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
| Sequence Similarities : | Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain. |
| Gene Name | CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ] |
| Official Symbol | CACNB2 |
| Synonyms | CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2; |
| Gene ID | 783 |
| mRNA Refseq | NM_000724 |
| Protein Refseq | NP_000715 |
| MIM | 600003 |
| Uniprot ID | Q08289 |
| Chromosome Location | 10p12 |
| Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; |
| Function | calcium channel activity; calcium channel regulator activity; protein binding; voltage-gated calcium channel activity; voltage-gated ion channel activity; |
| ◆ Recombinant Proteins | ||
| CACNB2-7856H | Recombinant Human CACNB2 protein, His-tagged | +Inquiry |
| CACNB2-332H | Recombinant Human CACNB2 Protein, His-tagged | +Inquiry |
| CACNB2-10639H | Recombinant Human CACNB2, His-tagged | +Inquiry |
| CACNB2-13HFL | Recombinant Full Length Human CACNB2 Protein, His-tagged | +Inquiry |
| CACNB2-601R | Recombinant Rhesus monkey CACNB2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNB2 Products
Required fields are marked with *
My Review for All CACNB2 Products
Required fields are marked with *
