"CACNB2" Related Products

Recombinant Human CACNB2

Cat.No.: CACNB2-26766TH
Product Overview: Recombinant fragment of Human CACNB2 with N terminal proprietary tag, 35.42kDa inclusive of tag.
Description: This gene encodes a subunit of a voltage-dependent calcium channel protein which is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome which is an autoimmune disorder. Mutations in this gene are associated with Brugada symdrome. Alternatively spliced variants have been identified for this gene.
Protein length: 89 amino acids
Molecular Weight: 35.420kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in all tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Sequence Similarities: Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.
Gene Name: CACNB2 calcium channel, voltage-dependent, beta 2 subunit [ Homo sapiens ]
Official Symbol: CACNB2
Synonyms: CACNB2; calcium channel, voltage-dependent, beta 2 subunit; CACNLB2, MYSB; voltage-dependent L-type calcium channel subunit beta-2;
Gene ID: 783
mRNA Refseq: NM_000724
Protein Refseq: NP_000715
MIM: 600003
Uniprot ID: Q08289
Chromosome Location: 10p12
Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem;
Function: calcium channel activity; calcium channel regulator activity; protein binding; voltage-gated calcium channel activity; voltage-gated ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.