"CALCR" Related Products

Expand
Expand
Expand

Recombinant Human CALCR

Cat.No.: CALCR-27793TH
Product Overview: Recombinant fragment: CNNEVQTTVK RQWAQFKIQW NQRWGRRPSN RSARAAAAAA EAGDIPIYIC HQELRNEPAN NQGEESAEII PLNIIEQESS A corresponding to amino acids 394-474 of Human Calcitonin receptor with an N terminal proprietary tag; Predicted MWt 34.54 kDa.
Description: This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants.
Protein length: 81 amino acids
Molecular Weight: 34.540kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
Sequence Similarities: Belongs to the G-protein coupled receptor 2 family.
Gene Name: CALCR calcitonin receptor [ Homo sapiens ]
Official Symbol: CALCR
Synonyms: CALCR; calcitonin receptor; CTR;
Gene ID: 799
mRNA Refseq: NM_001164737
Protein Refseq: NP_001158209
MIM: 114131
Uniprot ID: P30988
Chromosome Location: 7q21.3
Pathway: Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function: calcitonin binding; NOT calcitonin binding; calcitonin binding; calcitonin receptor activity; calcitonin receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.