Recombinant Human CALCR
| Cat.No. : | CALCR-27793TH |
| Product Overview : | Recombinant fragment: CNNEVQTTVK RQWAQFKIQW NQRWGRRPSN RSARAAAAAA EAGDIPIYIC HQELRNEPAN NQGEESAEII PLNIIEQESS A corresponding to amino acids 394-474 of Human Calcitonin receptor with an N terminal proprietary tag; Predicted MWt 34.54 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 81 amino acids |
| Description : | This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. |
| Molecular Weight : | 34.540kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA |
| Sequence Similarities : | Belongs to the G-protein coupled receptor 2 family. |
| Gene Name | CALCR calcitonin receptor [ Homo sapiens ] |
| Official Symbol | CALCR |
| Synonyms | CALCR; calcitonin receptor; CTR; |
| Gene ID | 799 |
| mRNA Refseq | NM_001164737 |
| Protein Refseq | NP_001158209 |
| MIM | 114131 |
| Uniprot ID | P30988 |
| Chromosome Location | 7q21.3 |
| Pathway | Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
| Function | calcitonin binding; NOT calcitonin binding; calcitonin binding; calcitonin receptor activity; calcitonin receptor activity; |
| ◆ Cell & Tissue Lysates | ||
| CALCR-272HCL | Recombinant Human CALCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCR Products
Required fields are marked with *
My Review for All CALCR Products
Required fields are marked with *
