"CAPN3" Related Products

Expand
Expand

Recombinant Human CAPN3

Cat.No.: CAPN3-27402TH
Product Overview: Recombinant fragment of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Description: Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform I is skeletal muscle specific.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains.
Gene Name: CAPN3 calpain 3, (p94) [ Homo sapiens ]
Official Symbol: CAPN3
Synonyms: CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94;
Gene ID: 825
mRNA Refseq: NM_000070
Protein Refseq: NP_000061
MIM: 114240
Uniprot ID: P20807
Chromosome Location: 15q15.1
Pathway: Integrin-mediated cell adhesion, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.