Recombinant Human CAPN3

Cat.No. : CAPN3-27402TH
Product Overview : Recombinant fragment of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Isoform I is skeletal muscle specific.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Sequence Similarities : Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains.
Gene Name CAPN3 calpain 3, (p94) [ Homo sapiens ]
Official Symbol CAPN3
Synonyms CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94;
Gene ID 825
mRNA Refseq NM_000070
Protein Refseq NP_000061
MIM 114240
Uniprot ID P20807
Chromosome Location 15q15.1
Pathway Integrin-mediated cell adhesion, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPN3 Products

Required fields are marked with *

My Review for All CAPN3 Products

Required fields are marked with *

0
cart-icon