Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CARHSP1, His-tagged

Cat.No. : CARHSP1-26810TH
Product Overview : Recombinant fragment, corresponding to amino acids 26-147 of Human CARHSP1 with N terminal His tag; Predicted MWt 14 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : CARHSP1 is a serine phosphoprotein originally identified as a physiological substrate for the Ca2+-calmodulin regulated protein phosphatase calcineurin (PP2B).
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 73 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKG VCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS GHVISS
Sequence Similarities : Contains 1 CSD (cold-shock) domain.
Gene Name : CARHSP1 calcium regulated heat stable protein 1, 24kDa [ Homo sapiens ]
Official Symbol : CARHSP1
Synonyms : CARHSP1; calcium regulated heat stable protein 1, 24kDa; calcium regulated heat stable protein 1 (24kD); calcium-regulated heat stable protein 1; CRHSP 24; CSDC1;
Gene ID : 23589
mRNA Refseq : NM_001042476
Protein Refseq : NP_001035941
Uniprot ID : Q9Y2V2
Chromosome Location : 16p13.2
Function : DNA binding; RNA binding; mRNA 3-UTR binding; phosphatase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CARHSP1 Products

Required fields are marked with *

My Review for All CARHSP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends