Recombinant Human CARHSP1, His-tagged
| Cat.No. : | CARHSP1-26810TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 26-147 of Human CARHSP1 with N terminal His tag; Predicted MWt 14 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 26-147 a.a. | 
| Description : | CARHSP1 is a serine phosphoprotein originally identified as a physiological substrate for the Ca2+-calmodulin regulated protein phosphatase calcineurin (PP2B). | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 73 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | SRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKG VCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS GHVISS | 
| Sequence Similarities : | Contains 1 CSD (cold-shock) domain. | 
| Gene Name | CARHSP1 calcium regulated heat stable protein 1, 24kDa [ Homo sapiens ] | 
| Official Symbol | CARHSP1 | 
| Synonyms | CARHSP1; calcium regulated heat stable protein 1, 24kDa; calcium regulated heat stable protein 1 (24kD); calcium-regulated heat stable protein 1; CRHSP 24; CSDC1; | 
| Gene ID | 23589 | 
| mRNA Refseq | NM_001042476 | 
| Protein Refseq | NP_001035941 | 
| Uniprot ID | Q9Y2V2 | 
| Chromosome Location | 16p13.2 | 
| Function | DNA binding; RNA binding; mRNA 3-UTR binding; phosphatase binding; | 
| ◆ Recombinant Proteins | ||
| CARHSP1-456R | Recombinant Rhesus Macaque CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CARHSP1-26810TH | Recombinant Human CARHSP1, His-tagged | +Inquiry | 
| CARHSP1-0401H | Recombinant Human CARHSP1 Protein, GST-Tagged | +Inquiry | 
| CARHSP1-628R | Recombinant Rhesus monkey CARHSP1 Protein, His-tagged | +Inquiry | 
| CARHSP1-454H | Recombinant Human CARHSP1 protein(Met1-Ser147), His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CARHSP1-7847HCL | Recombinant Human CARHSP1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARHSP1 Products
Required fields are marked with *
My Review for All CARHSP1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            