Recombinant Human CARHSP1, His-tagged
Cat.No. : | CARHSP1-26810TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-147 of Human CARHSP1 with N terminal His tag; Predicted MWt 14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-147 a.a. |
Description : | CARHSP1 is a serine phosphoprotein originally identified as a physiological substrate for the Ca2+-calmodulin regulated protein phosphatase calcineurin (PP2B). |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 73 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKG VCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS GHVISS |
Sequence Similarities : | Contains 1 CSD (cold-shock) domain. |
Gene Name | CARHSP1 calcium regulated heat stable protein 1, 24kDa [ Homo sapiens ] |
Official Symbol | CARHSP1 |
Synonyms | CARHSP1; calcium regulated heat stable protein 1, 24kDa; calcium regulated heat stable protein 1 (24kD); calcium-regulated heat stable protein 1; CRHSP 24; CSDC1; |
Gene ID | 23589 |
mRNA Refseq | NM_001042476 |
Protein Refseq | NP_001035941 |
Uniprot ID | Q9Y2V2 |
Chromosome Location | 16p13.2 |
Function | DNA binding; RNA binding; mRNA 3-UTR binding; phosphatase binding; |
◆ Recombinant Proteins | ||
CARHSP1-26089TH | Recombinant Human CARHSP1, HA-tagged | +Inquiry |
CARHSP1-796R | Recombinant Rat CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARHSP1-456R | Recombinant Rhesus Macaque CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARHSP1-1138R | Recombinant Rat CARHSP1 Protein | +Inquiry |
CARHSP1-0401H | Recombinant Human CARHSP1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARHSP1-7847HCL | Recombinant Human CARHSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARHSP1 Products
Required fields are marked with *
My Review for All CARHSP1 Products
Required fields are marked with *
0
Inquiry Basket