"CAST" Related Products

Expand
Expand

Recombinant Human CAST

Cat.No.: CAST-27210TH
Product Overview: Recombinant fragment corresponding to amino acids 582-669 of Human Calpastatin with an N terminal proprietary tag; Predicted MWt 35.31 kDa.
Description: The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein length: 88 amino acids
Molecular Weight: 35.310kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ
Sequence Similarities: Belongs to the protease inhibitor I27 (calpastatin) family.
Gene Name: CAST calpastatin [ Homo sapiens ]
Official Symbol: CAST
Synonyms: CAST; calpastatin;
Gene ID: 831
mRNA Refseq: NM_001042440
Protein Refseq: NP_001035905
MIM: 114090
Uniprot ID: P20810
Chromosome Location: 5q14-q22
Function: calcium-dependent cysteine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.