"CBL" Related Products

Expand
Expand

Recombinant Human CBL

Cat.No. : CBL-26492TH
Product Overview : Recombinant full length Human CBL protein with an N terminal proprietary tag; predicted mwt: 125.73 kDa inclusive of tag.
Description : The cbl oncogene was first identified as part of a transforming retrovirus which induces mouse pre-B and pro-B cell lymphomas. As an adaptor protein for receptor protein-tyrosine kinases, it positively regulates receptor protein-tyrosine kinase ubiquitination in a manner dependent upon its variant SH2 and RING finger domains. Ubiquitination of receptor protein-tyrosine kinases terminates signaling by marking active receptors for degradation.
Protein length : 906 amino acids
Molecular Weight : 125.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHH HHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNS PPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSH MLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIV PWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKAR LQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPH NKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLM CTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSG SLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTAS KAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRP QRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGST FSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARP LPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHA NTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSF GWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVI AQNNIEMAKNILREFVSISSPAHVAT
Sequence Similarities : Contains 1 Cbl-PTB (Cbl-type phosphotyrosine-binding) domain.Contains 1 RING-type zinc finger.Contains 1 UBA domain.
Gene Name : CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence [ Homo sapiens ]
Official Symbol : CBL
Synonyms : CBL; Cas-Br-M (murine) ecotropic retroviral transforming sequence; CBL2; E3 ubiquitin-protein ligase CBL; c Cbl; oncogene CBL2; RNF55;
Gene ID : 867
mRNA Refseq : NM_005188
Protein Refseq : NP_005179
MIM : 165360
Uniprot ID : P22681
Chromosome Location : 11q23.3-qter
Pathway : B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; CDC42 signaling events, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem;
Function : SH3 domain binding; calcium ion binding; ephrin receptor binding; ligase activity; phosphotyrosine binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.