Recombinant Human CBX5, His-tagged

• Cat.No.: CBX5-27763TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-191 of Human HP1 alpha with N terminal His tag, Predicted MWt 23 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-191 a.a.
• Description: This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 163 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLK WKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGEN NKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARG FERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAK EANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
• Sequence Similarities: Contains 2 chromo domains.
• Full Length: Full L.

Gene Information

• Gene Name: CBX5 chromobox homolog 5 [ Homo sapiens ]
• Official Symbol: CBX5
• Synonyms: CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha
• Gene ID: 23468
• mRNA Refseq: NM_001127321
• Protein Refseq: NP_001120793
• MIM: 604478
• Uniprot ID: P45973
• Chromosome Location: 12q13.13
• Pathway: Aurora B signaling, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding