Recombinant Human CBX5, His-tagged CBX5-27763TH

Recombinant Human CBX5, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CBX5, His-tagged

Recombinant Human CBX5, His-tagged

CBX5 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CBX5-27763TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-191 of Human HP1 alpha with N terminal His tag, Predicted MWt 23 kDa.
Description : This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 163 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLK WKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGEN NKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARG FERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAK EANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Sequence Similarities : Contains 2 chromo domains.
Gene Name : CBX5 chromobox homolog 5 [ Homo sapiens ]
Official Symbol : CBX5
Synonyms : CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha;
Gene ID : 23468
mRNA Refseq : NM_001127321
Protein Refseq : NP_001120793
MIM : 604478
Uniprot ID : P45973
Chromosome Location : 12q13.13
Pathway : Aurora B signaling, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy