Recombinant Human CBX5, His-tagged
Cat.No. : | CBX5-27763TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-191 of Human HP1 alpha with N terminal His tag, Predicted MWt 23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 163 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLK WKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGEN NKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARG FERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAK EANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
Sequence Similarities : | Contains 2 chromo domains. |
Protein length : | 1-191 |
Gene Name : | CBX5 chromobox homolog 5 [ Homo sapiens ] |
Official Symbol : | CBX5 |
Synonyms : | CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; |
Gene ID : | 23468 |
mRNA Refseq : | NM_001127321 |
Protein Refseq : | NP_001120793 |
MIM : | 604478 |
Uniprot ID : | P45973 |
Chromosome Location : | 12q13.13 |
Pathway : | Aurora B signaling, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function : | chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
CBX5-476R | Recombinant Rhesus Macaque CBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX5-0483H | Recombinant Human CBX5 Protein, GST-Tagged | +Inquiry |
CBX5-1272M | Recombinant Mouse CBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbx5-794M | Recombinant Mouse Cbx5 Protein, MYC/DDK-tagged | +Inquiry |
CBX5-516H | Recombinant Human CBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CBX5-7802HCL | Recombinant Human CBX5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBX5 Products
Required fields are marked with *
My Review for All CBX5 Products
Required fields are marked with *
0
Inquiry Basket