Recombinant Human CC2D1A, His-tagged CC2D1A-26320TH

Recombinant Human CC2D1A, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CC2D1A, His-tagged

Recombinant Human CC2D1A, His-tagged

CC2D1A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CC2D1A-26320TH
Product Overview : Recombinant fragment, corresponding to amino acids 672-951 of Human CC2D1A with N terminal His tag; Predicted MWt 33 kDa.
Description : This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 106 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFK EQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDR VLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVM VRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKG KAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRR EYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNL VESELQRLRR
Gene Name : CC2D1A coiled-coil and C2 domain containing 1A [ Homo sapiens ]
Official Symbol : CC2D1A
Synonyms : CC2D1A; coiled-coil and C2 domain containing 1A; coiled-coil and C2 domain-containing protein 1A; FLJ20241; mental retardation; nonsyndromic; autosomal recessive; 3; MRT3;
Gene ID : 54862
mRNA Refseq : NM_017721
Protein Refseq : NP_060191
MIM : 610055
Uniprot ID : Q6P1N0
Chromosome Location : 19p13.12
Pathway : SIDS Susceptibility Pathways, organism-specific biosystem;
Function : DNA binding; signal transducer activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy