"CC2D1A" Related Products

Expand

Recombinant Human CC2D1A, His-tagged

Cat.No.: CC2D1A-26320TH
Product Overview: Recombinant fragment, corresponding to amino acids 672-951 of Human CC2D1A with N terminal His tag; Predicted MWt 33 kDa.
Description: This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 106 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFK EQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDR VLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVM VRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKG KAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRR EYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNL VESELQRLRR
Gene Name: CC2D1A coiled-coil and C2 domain containing 1A [ Homo sapiens ]
Official Symbol: CC2D1A
Synonyms: CC2D1A; coiled-coil and C2 domain containing 1A; coiled-coil and C2 domain-containing protein 1A; FLJ20241; mental retardation; nonsyndromic; autosomal recessive; 3; MRT3;
Gene ID: 54862
mRNA Refseq: NM_017721
Protein Refseq: NP_060191
MIM: 610055
Uniprot ID: Q6P1N0
Chromosome Location: 19p13.12
Pathway: SIDS Susceptibility Pathways, organism-specific biosystem;
Function: DNA binding; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.