Recombinant Human CCL16

Cat.No. : CCL16-29941TH
Product Overview : Recombinant full length mature Human LEC, amino acids 24-120, predicted MW: 11.2kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 97 amino acids
Description : This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.
Molecular Weight : 11.200kDa
Tissue specificity : Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
Biological activity : Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg.
Form : Lyophilised:It is recommended to reconstitute the lyophilized protein in sterile ultra pure water not less than 100μg/ml, which can then be further diluted into other aqueous solutions.
Purity : by SDS-PAGE
Storage buffer : pH: 7.40Constituents:0.88% Sodium chloride, 0.28% Sodium phosphate
Storage : Please see Notes section
Sequences of amino acids : QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
Official Symbol CCL16
Synonyms CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4;
Gene ID 6360
mRNA Refseq NM_004590
Protein Refseq NP_004581
MIM 601394
Uniprot ID O15467
Chromosome Location 17q11.2
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function chemoattractant activity; chemokine activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL16 Products

Required fields are marked with *

My Review for All CCL16 Products

Required fields are marked with *

0
cart-icon
0
compare icon