Recombinant Human CCL3, His-tagged
Cat.No. : | CCL3-29859TH |
Product Overview : | Recombinant full length Human Macrophage Inflammatory Protein 1 alpha / CCL3 with N terminal His tag; 90 amino acids with tag, Predicted MWt 10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 69 amino acids |
Description : | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1. |
Conjugation : | HIS |
Molecular Weight : | 10.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
Uniprot ID | P10147 |
Chromosome Location | 17q12 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; |
Function | chemoattractant activity; chemokine activity; signal transducer activity; |
◆ Recombinant Proteins | ||
CCL3-691R | Recombinant Rhesus monkey CCL3 Protein, His-tagged | +Inquiry |
Ccl3-132M | Active Recombinant Mouse Ccl3 Protein | +Inquiry |
Ccl3-707R | Recombinant Rat Ccl3 protein, His & GST-tagged | +Inquiry |
CCL3-704D | Recombinant Dog CCL3 protein, His & GST-tagged | +Inquiry |
CCL3-4453H | Recombinant Human CCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *