Recombinant Human CCNB2, His-tagged CCNB2-27516TH

Recombinant Human CCNB2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CCNB2, His-tagged

Recombinant Human CCNB2, His-tagged

CCNB2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CCNB2-27516TH
Product Overview : Recombinant fragment, corresponding to amino acids 214-396 of Human Cyclin B2 with N terminal His tag; 183 amino acids, 21kDa.
Description : Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 119 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLI LKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLM ELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQY YTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYA SSKLLKISMIPQLNSKAVKDLASPLIG
Gene Name : CCNB2 cyclin B2 [ Homo sapiens ]
Official Symbol : CCNB2
Synonyms : CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299;
Gene ID : 9133
mRNA Refseq : NM_004701
Protein Refseq : NP_004692
MIM : 602755
Uniprot ID : O95067
Chromosome Location : 15q21.3
Pathway : Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem;
Function : protein kinase binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy