Recombinant Full Length Human CCNB2 Protein, GST-tagged
Cat.No. : | CCNB2-2962HF |
Product Overview : | Human CCNB2 full-length ORF (BAG50905.1, 1 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 398 amino acids |
Description : | Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 71.7 kDa |
AA Sequence : | MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNB2 cyclin B2 [ Homo sapiens ] |
Official Symbol | CCNB2 |
Synonyms | CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299; |
Gene ID | 9133 |
mRNA Refseq | NM_004701 |
Protein Refseq | NP_004692 |
MIM | 602755 |
UniProt ID | O95067 |
◆ Recombinant Proteins | ||
CCNB2-0655H | Recombinant Human CCNB2 Protein, GST-Tagged | +Inquiry |
CCNB2-1188C | Recombinant Chicken CCNB2 | +Inquiry |
CCNB2-10858H | Recombinant Human CCNB2, His-tagged | +Inquiry |
CCNB2-0654H | Recombinant Human CCNB2 Protein, His-Tagged | +Inquiry |
CCNB2-0895H | Recombinant Human CCNB2 Protein (Val58-Ser398), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB2-7716HCL | Recombinant Human CCNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB2 Products
Required fields are marked with *
My Review for All CCNB2 Products
Required fields are marked with *