Recombinant Human CCT2, His-tagged CCT2-27951TH

Recombinant Human CCT2, His-tagged

PRODUCTS

Home / Products / Recombinant Human CCT2, His-tagged

Recombinant Human CCT2, His-tagged

CCT2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CCT2-27951TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-487 of Human TCP1 beta with N terminal His tag; MWt 56 kDa.
Description : The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 68 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVK STLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDN PAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESL IAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFR QDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSG NLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRI ENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHA EKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVM AIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKL IEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEA ERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQ LRAAHSEGNTTAGLDMREGTIGD
Sequence Similarities : Belongs to the TCP-1 chaperonin family.
Gene Name : CCT2 chaperonin containing TCP1, subunit 2 (beta) [ Homo sapiens ]
Official Symbol : CCT2
Synonyms : CCT2; chaperonin containing TCP1, subunit 2 (beta); T-complex protein 1 subunit beta; Cctb;
Gene ID : 10576
mRNA Refseq : NM_001198842
Protein Refseq : NP_001185771
MIM : 605139
Uniprot ID : P78371
Chromosome Location : 12q14
Pathway : Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem;
Function : ATP binding; nucleotide binding; unfolded protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy