Recombinant Human CCT2, His-tagged
Cat.No. : | CCT2-27951TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-487 of Human TCP1 beta with N terminal His tag; MWt 56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-487 a.a. |
Description : | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVK STLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDN PAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESL IAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFR QDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSG NLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRI ENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHA EKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVM AIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKL IEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEA ERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQ LRAAHSEGNTTAGLDMREGTIGD |
Sequence Similarities : | Belongs to the TCP-1 chaperonin family. |
Gene Name | CCT2 chaperonin containing TCP1, subunit 2 (beta) [ Homo sapiens ] |
Official Symbol | CCT2 |
Synonyms | CCT2; chaperonin containing TCP1, subunit 2 (beta); T-complex protein 1 subunit beta; Cctb; |
Gene ID | 10576 |
mRNA Refseq | NM_001198842 |
Protein Refseq | NP_001185771 |
MIM | 605139 |
Uniprot ID | P78371 |
Chromosome Location | 12q14 |
Pathway | Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
CCT2-540R | Recombinant Rhesus Macaque CCT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT2-11501Z | Recombinant Zebrafish CCT2 | +Inquiry |
CCT2-2657H | Recombinant Human CCT2 protein, His-SUMO-tagged | +Inquiry |
CCT2-27951TH | Recombinant Human CCT2, His-tagged | +Inquiry |
CCT2-130C | Recombinant Cynomolgus Monkey CCT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT2-7691HCL | Recombinant Human CCT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCT2 Products
Required fields are marked with *
My Review for All CCT2 Products
Required fields are marked with *