"CCT5" Related Products

Expand
Expand
Expand

Recombinant Human CCT5, His-tagged

Cat.No.: CCT5-27006TH
Product Overview: Recombinant fragment, corresponding to amino acids 163-541 of Human TCP1 epsilon with an N terminal His tag. Predicted MWt: 43 kDa.
Description: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. In addition, three pseudogenes of this gene have been identified.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 65 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERR DVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMP KKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQ KYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQ NNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFA GLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMI IEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALA VSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNP IQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIE TLIGKKQQISLATQMVRMILKIDDIRKPGESEE
Gene Name: CCT5 chaperonin containing TCP1, subunit 5 (epsilon) [ Homo sapiens ]
Official Symbol: CCT5
Synonyms: CCT5; chaperonin containing TCP1, subunit 5 (epsilon); T-complex protein 1 subunit epsilon; KIAA0098;
Gene ID: 22948
mRNA Refseq: NM_012073
Protein Refseq: NP_036205
MIM: 610150
Uniprot ID: P48643
Chromosome Location: 5
Pathway: Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem;
Function: ATP binding; nucleotide binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.