"CD19" Related Products

Expand
Expand
Expand

Recombinant Human CD19

Cat.No.: CD19-27864TH
Product Overview: Recombinant Human CD19 fragment, amino acids 98-187 with a proprietary N-terminal tag; molecular weight 35.53 kDa inclusive of tag
Description: Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Sequence Similarities: Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: CD19 CD19 molecule [ Homo sapiens ]
Official Symbol: CD19
Synonyms: CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19;
Gene ID: 930
mRNA Refseq: NM_001178098
Protein Refseq: NP_001171569
MIM: 107265
Uniprot ID: P15391
Chromosome Location: 16p11.2
Pathway: Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem;
Function: receptor signaling protein activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.