Recombinant Human CD19

• Cat.No.: CD19-27864TH
• Product Overview: Recombinant Human CD19 fragment, amino acids 98-187 with a proprietary N-terminal tag; molecular weight 35.53 kDa inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
• Sequence Similarities: Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: CD19 CD19 molecule [ Homo sapiens ]
• Official Symbol: CD19
• Synonyms: CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19
• Gene ID: 930
• mRNA Refseq: NM_001178098
• Protein Refseq: NP_001171569
• MIM: 107265
• Uniprot ID: P15391
• Chromosome Location: 16p11.2
• Pathway: Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem
• Function: receptor signaling protein activity