Recombinant Human CD19
| Cat.No. : | CD19-27864TH |
| Product Overview : | Recombinant Human CD19 fragment, amino acids 98-187 with a proprietary N-terminal tag; molecular weight 35.53 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD |
| Sequence Similarities : | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Gene Name | CD19 CD19 molecule [ Homo sapiens ] |
| Official Symbol | CD19 |
| Synonyms | CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19; |
| Gene ID | 930 |
| mRNA Refseq | NM_001178098 |
| Protein Refseq | NP_001171569 |
| MIM | 107265 |
| Uniprot ID | P15391 |
| Chromosome Location | 16p11.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; |
| Function | receptor signaling protein activity; |
| ◆ Recombinant Proteins | ||
| CD19-2359H | Recombinant Human CD19 protein, His-tagged | +Inquiry |
| CD19-3307HAF647 | Active Recombinant Human CD19 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD19-128H | Recombinant Human CD19 Protein, Fc-tagged | +Inquiry |
| CD19-3308H | Active Recombinant Human CD19, Fc tagged | +Inquiry |
| CD19-159CF | Recombinant Monkey CD19 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD19-2164MCL | Recombinant Mouse CD19 cell lysate | +Inquiry |
| CD19-2005HCL | Recombinant Human CD19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD19 Products
Required fields are marked with *
My Review for All CD19 Products
Required fields are marked with *




