Recombinant Human CD1B
| Cat.No. : | CD1B-27106TH |
| Product Overview : | Recombinant fragment of Human CD1b (amino acids 19-110) with N terminal proprietary tag, 35.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 92 amino acids |
| Description : | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. |
| Molecular Weight : | 35.750kDa inclusive of tags |
| Tissue specificity : | Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY |
| Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
| Gene Name | CD1B CD1b molecule [ Homo sapiens ] |
| Official Symbol | CD1B |
| Synonyms | CD1B; CD1b molecule; CD1, CD1b antigen , CD1B antigen, b polypeptide; T-cell surface glycoprotein CD1b; |
| Gene ID | 910 |
| mRNA Refseq | NM_001764 |
| Protein Refseq | NP_001755 |
| MIM | 188360 |
| Uniprot ID | P29016 |
| Chromosome Location | 1q22-q23 |
| Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function | protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1B Products
Required fields are marked with *
My Review for All CD1B Products
Required fields are marked with *




